Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COUP transcription factor 1 (NR2F1)

Product Specifications

Product Name Alternative

(COUP-TF1) (COUP transcription factor I) (COUP-TF I) (Nuclear receptor subfamily 2 group F member 1) (V-erbA-related protein 3) (EAR-3)

Abbreviation

Recombinant Human NR2F1 protein

Gene Name

NR2F1

UniProt

P10589

Expression Region

1-423aa

Organism

Homo sapiens (Human)

Target Sequence

MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. Binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif. Represses transcriptional activity of LHCG.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.2 kDa

References & Citations

"EAR2 and EAR3/COUP-TFI regulate transcription of the rat LH receptor." Zhang Y., Dufau M.L. Mol. Endocrinol. 15:1891-1905 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF174 (NM_001032292) Human Tagged Lenti ORF Clone
RC200400L4 10 µg

ZNF174 (NM_001032292) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-CD105/ENG Polyclonal Antibody
PAV5613 100 μL

Rabbit Anti-CD105/ENG Polyclonal Antibody

Sign In for Pricing
View Details
NKX1-1 Antibody - middle region : Biotin (ARP47803_P050-Biotin)
ARP47803_P050-Biotin 100 µL

NKX1-1 Antibody - middle region : Biotin (ARP47803_P050-Biotin)

Sign In for Pricing
View Details
Rat Calcitonin gene related peptide type 1 receptor (CALCRL) ELISA kit
GTR10459988 96 Well

Rat Calcitonin gene related peptide type 1 receptor (CALCRL) ELISA kit

Sign In for Pricing
View Details
ADRA1B sgRNA CRISPR Lentivector set (Human)
K0052201 3x 1.0 µg

ADRA1B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Goat Anti-Human IgA - AP
BS21429-01 100 µL

Goat Anti-Human IgA - AP

Sign In for Pricing
View Details