Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-23, Mouse (HEK293, C-His)

IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing mouse-derived IL-23 alpha, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-23 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-23-protein-mouse-hek293-his.html

Purity

98.0

Smiles

VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Formula

83430&16160 (Gene_ID) Q9EQ14 (V22-A196) &P43432 (M23-S335) (Accession)

Molecular Weight

Approximately 40-55 kDa (p40) &19kDa (p19), due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbp2 (NM_009034) Mouse Recombinant Protein
TP517546 20 µg

Rbp2 (NM_009034) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human SOS1 shRNA (UAS) - Lentiviral human SOS1 shRNA (UAS) (25)
GTR15086669 1 Vial

Lentiviral human SOS1 shRNA (UAS) - Lentiviral human SOS1 shRNA (UAS) (25)

Sign In for Pricing
View Details
OR2AF1P CRISPR Knock Out 293T Cell Line (Human)
35039141 1x 10^6 Cells / 1.0 mL

OR2AF1P CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Polyclonal Antibody to Hairy And Enhancer Of Split 1 (HES1)
TRV-0058625-01 20 µL

Polyclonal Antibody to Hairy And Enhancer Of Split 1 (HES1)

Sign In for Pricing
View Details
Polyclonal Antibody to Hairy And Enhancer Of Split 1 (HES1)
TRV-0058625-02 100 µL

Polyclonal Antibody to Hairy And Enhancer Of Split 1 (HES1)

Sign In for Pricing
View Details
Polyclonal Antibody to Hairy And Enhancer Of Split 1 (HES1)
TRV-0058625-03 200 µL

Polyclonal Antibody to Hairy And Enhancer Of Split 1 (HES1)

Sign In for Pricing
View Details