Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHH, Human (C24IVI)

Sonic Hedgehog (SHH) Protein is a secretory glycoprotein of the Hedgehog family that can self-cleave to form N-SHH. SHH Protein activates Smo by binding to Frizzled and LRP6, inhibits GSK-3β to stabilize β-catenin, and activates FOXM1. SHH Protein also promotes NO release and shortens myocardial APD by phosphorylating eNOS through PI3K/Akt. SHH Protein can promote the maturation of sweat gland cells in three-dimensional culture and play a cardioprotective role in the pig ischemia-reperfusion model[1][2]. SHH Protein, Human (C24IVI) is a recombinant human SHH protein expressed in E. coli with C24IVI-mutation and tag-free.

Product Specifications

Product Name Alternative

SHH Protein, Human (C24IVI), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-human-c24ivi.html

Purity

95.00

Smiles

GPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

6469 (Gene_ID) Q15465 (G25-G197) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Wang XZ, et al. Sonic hedgehog (Shh) and CC chemokine ligand 2 signaling pathways in asthma. J Chin Med Assoc. 2019;82 (5) :343-350.|[2]Seo H, et al. Upstream Enhancer Elements of Shh Regulate Oral and Dental Patterning. J Dent Res. 2018;97 (9) :1055-1063.|[3]Huang Z, et al. Shh promotes sweat gland cell maturation in three-dimensional culture. Cell Tissue Bank. 2016 Jun;17 (2) :317-25.|[4]Ghaleh B, et al. Cardioprotective effect of sonic hedgehog ligand in pig models of ischemia reperfusion. Theranostics. 2020 Mar 4;10 (9) :4006-4016.|[5]Spinella-Jaegle S, et al. Sonic hedgehog increases the commitment of pluripotent mesenchymal cells into the osteoblastic lineage and abolishes adipocytic differentiation. J Cell Sci. 2001 Jun;114 (Pt 11) :2085-94.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-100 1x 100 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF740 conjugate, 0.1mg/mL
BNC741786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details