Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-15, Human

The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. GMP IL-15 Protein, Human is the recombinant human-derived IL-15 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GMP IL-15 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-15-protein-human.html

Purity

95.90

Smiles

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Molecular Formula

3600 (Gene_ID) P40933-1 (N49-S162) (Accession)

Molecular Weight

Approximately 12.0 kDa

References & Citations

[1]Mori A, et al. IL-15 promotes cytokine production of human T helper cells[J]. Journal of immunology (Baltimore, Md.: 1950), 1996, 156 (7) : 2400-2405.|[2]Sun W, et al., High level expression and purification of active recombinant human interleukin-15 in Pichia pastoris. J Immunol Methods. 2016 Jan;428:50-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)
MBS1049649-01 0.02 mg (E-Coli)

Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)
MBS1049649-02 0.02 mg (Yeast)

Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)
MBS1049649-03 0.1 mg (E-Coli)

Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)
MBS1049649-04 0.1 mg (Yeast)

Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)
MBS1049649-05 0.02 mg (Baculovirus)

Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)
MBS1049649-06 0.02 mg (Mammalian-Cell)

Recombinant Pelobacter propionicus Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details