Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2)

Product Specifications

Product Name Alternative

(GM-CSF) (Colony-stimulating factor) (CSF)

Abbreviation

Recombinant Mouse Csf2 protein

Gene Name

Csf2

UniProt

P01587

Expression Region

18-141aa

Organism

Mus musculus (Mouse)

Target Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

References & Citations

"The genome sequence of the facultative intracellular pathogen Brucella melitensis." DelVecchio V.G., Kapatral V., Redkar R.J., Patra G., Mujer C., Los T., Ivanova N., Anderson I., Bhattacharyya A., Lykidis A., Reznik G., Jablonski L., Larsen N., D'Souza M., Bernal A., Mazur M., Goltsman E., Selkov E. Overbeek R. Proc. Natl. Acad. Sci. U.S.A. 99:443-448 (2002) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2R2 Antibody
OAAN02249-200UL 200 µL

UBE2R2 Antibody

Sign In for Pricing
View Details
Rab14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38300114 3x 1.0 µg

Rab14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-GSTT1 Antibody Picoband® (HRP Conjugate)
A01084-HRP 100 µg/Vial

Anti-GSTT1 Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Anti-Mouse CD45.2/Ly-5.2-APC Conjugate Antibody
MBS4151858-01 0.1 mg

Anti-Mouse CD45.2/Ly-5.2-APC Conjugate Antibody

Sign In for Pricing
View Details
Anti-Mouse CD45.2/Ly-5.2-APC Conjugate Antibody
MBS4151858-02 5x 0.1 mg

Anti-Mouse CD45.2/Ly-5.2-APC Conjugate Antibody

Sign In for Pricing
View Details
LOC100132167 Protein Vector (Human) (pPB-N-His)
PV023938 500 ng

LOC100132167 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details