Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2)

Product Specifications

Product Name Alternative

(GM-CSF) (Colony-stimulating factor) (CSF)

Abbreviation

Recombinant Mouse Csf2 protein

Gene Name

Csf2

UniProt

P01587

Expression Region

18-141aa

Organism

Mus musculus (Mouse)

Target Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

References & Citations

"The genome sequence of the facultative intracellular pathogen Brucella melitensis." DelVecchio V.G., Kapatral V., Redkar R.J., Patra G., Mujer C., Los T., Ivanova N., Anderson I., Bhattacharyya A., Lykidis A., Reznik G., Jablonski L., Larsen N., D'Souza M., Bernal A., Mazur M., Goltsman E., Selkov E. Overbeek R. Proc. Natl. Acad. Sci. U.S.A. 99:443-448 (2002) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRF1 (NRF1/2609), CF488A conjugate, 0.1mg/mL
BNC882609-100 1x 100 µL

NRF1 (NRF1/2609), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSL2L1 (MSL2) (NM_018133) Human Tagged Lenti ORF Clone
RC210829L3 10 µg

MSL2L1 (MSL2) (NM_018133) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GENLISA™ Bovine Collagen Type I Alpha 2 (COL1a2) ELISA
KLB2297 96 Well

GENLISA™ Bovine Collagen Type I Alpha 2 (COL1a2) ELISA

Sign In for Pricing
View Details
APC/iFluor® 750 Anti-human CD167a Antibody *51D6*
116701F2-AAT 500 Tests

APC/iFluor® 750 Anti-human CD167a Antibody *51D6*

Sign In for Pricing
View Details
Clock (h) -PR
sc-35074-PR 10 µM - 20 µL

Clock (h) -PR

Sign In for Pricing
View Details
TJP1 Antibody, HRP Conjugated
MBS7135003-01 0.05 mL

TJP1 Antibody, HRP Conjugated

Sign In for Pricing
View Details