Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) (Active)

Product Specifications

Product Name Alternative

(IAP-1) (Intestinal alkaline phosphatase 1) (Intestinal alkaline phosphatase I) (IAP-I)

Abbreviation

Recombinant Rat Alpi protein (Active)

Gene Name

Alpi

UniProt

P15693

Expression Region

21-511aa

Organism

Rattus norvegicus (Rat)

Target Sequence

VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN

Tag

N-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Alkaline phosphatase that can hydrolyze various phosphate compounds.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

YES

Bioactivity

Unit Definition:One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate (pNPP), in 1 minute at 37°C, pH10.0.The specific activity is >10370.37 U/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF4 Human siRNA Oligo Duplex (Locus ID 7293)
SR304979 1 Kit

TNFRSF4 Human siRNA Oligo Duplex (Locus ID 7293)

Sign In for Pricing
View Details
Guinea pig STE20-related kinase adapter protein alpha (STRADA) ELISA Kit
MBS7200939-01 48 Well

Guinea pig STE20-related kinase adapter protein alpha (STRADA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig STE20-related kinase adapter protein alpha (STRADA) ELISA Kit
MBS7200939-02 96 Well

Guinea pig STE20-related kinase adapter protein alpha (STRADA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig STE20-related kinase adapter protein alpha (STRADA) ELISA Kit
MBS7200939-03 5x 96 Well

Guinea pig STE20-related kinase adapter protein alpha (STRADA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig STE20-related kinase adapter protein alpha (STRADA) ELISA Kit
MBS7200939-04 10x 96 Well

Guinea pig STE20-related kinase adapter protein alpha (STRADA) ELISA Kit

Sign In for Pricing
View Details
CASPR Rabbit Polyclonal Antibody (Cy7)
orb1014123 100 µL

CASPR Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details