Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Langerin/CD207, Rhesus Macaque (HEK293, Fc)

Langerin, also known as CD207, is a calcium-dependent lectin with mannose-binding specificity. Notably, it induces the formation of Birbeck granules (BG) and acts as an effective regulator of membrane stacking and zipping. Langerin/CD207 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Langerin/CD207 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Langerin/CD207 Protein, Rhesus Macaque (HEK293, Fc), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/langerin-cd207-protein-rhesus-macaque-hek293-fc.html

Purity

96.00

Smiles

PRFMGNISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQTVNVSLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVGTLNAQIPELKSDLEKASALNTKIRALQGSLDNMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLVTKTWYSAQQFCVSRNSHLTSVTSESEQEFLYKTAGGLTYWIGLTKAGMEGDWFWVDDTPFDKVQSAKFWIPGEPNNAGNNEHCGNIRVSSLQAWNDAQCDKTFLFICKRPYIPSEP

Molecular Formula

/ (Gene_ID) EHH22200.1 (P65-P328) (Accession)

Molecular Weight

Approximately 65-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-100 1x 100 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-500 1x 500 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-500 1x 500 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details