Kras4B, Human (G13V, His)
KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. Kras4B Protein, Human (G13V, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G13V mutation.
Product Specifications
Product Name Alternative
Kras4B Protein, Human (G13V, His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/kras-protein-human-g13v-his.html
Purity
98.50
Smiles
TEYKLVVVGAGVVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Molecular Formula
3845 (Gene_ID) AAH13572.1 (T2-C185, G13V) (Accession)
Molecular Weight
Approximately 25 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880096-100 1x 100 µL
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details