Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUCL1, Human (HEK293, His)

The MUCL1 protein has the potential to serve as a diagnostic marker for metastatic breast cancer, providing utility in identifying and characterizing this disease stage. It can serve as a molecular marker to aid diagnosis and evaluation and have an impact on treatment planning and prognosis. MUCL1 Protein, Human (HEK293, His) is the recombinant human-derived MUCL1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

MUCL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mucl1-protein-human-hek293-his.html

Purity

95.00

Smiles

NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP

Molecular Formula

118430 (Gene_ID) Q96DR8 (N21-P90) (Accession)

Molecular Weight

Approximately 20-30 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF594 conjugate, 0.1mg/mL
BNC941266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details