Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUCL1, Human (HEK293, His)

The MUCL1 protein has the potential to serve as a diagnostic marker for metastatic breast cancer, providing utility in identifying and characterizing this disease stage. It can serve as a molecular marker to aid diagnosis and evaluation and have an impact on treatment planning and prognosis. MUCL1 Protein, Human (HEK293, His) is the recombinant human-derived MUCL1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

MUCL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mucl1-protein-human-hek293-his.html

Purity

95.00

Smiles

NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP

Molecular Formula

118430 (Gene_ID) Q96DR8 (N21-P90) (Accession)

Molecular Weight

Approximately 20-30 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HERC2P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV762672 1.0 µg DNA

HERC2P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
KLF12 polyclonal antibody
orb1725820-01 50 µL

KLF12 polyclonal antibody

Sign In for Pricing
View Details
KLF12 polyclonal antibody
orb1725820-02 100 µL

KLF12 polyclonal antibody

Sign In for Pricing
View Details
GTDC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
22781111 3x 1.0 µg

GTDC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Srsf10 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4715404 1.0 µg DNA

Srsf10 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-CCR6  Antibody, Dylight550 Conjugate
A00957-Dylight550 100 µg

Anti-CCR6 Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details