Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5D, Human (His)

ATP5D Protein, a vital component of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. As part of the F (1) domain and central stalk, ATP5D contributes to ATP hydrolysis through a rotary mechanism. The ATP synthase complex, involving ATP5D, is pivotal for cellular energy production via ATP synthesis. ATP5D Protein, Human (His) is the recombinant human-derived ATP5D protein, expressed by E. coli , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5d-protein-human-his.html

Purity

95.00

Smiles

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Molecular Formula

513 (Gene_ID) P30049 (A23-E168) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Rectum
CS649566 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
10-Oxo Samidorphan
TRC-O311990-50MG 50 mg

10-Oxo Samidorphan

Sign In for Pricing
View Details
Ly6g Recombinant Rabbit monoclonal Antibody
HA723696 100 µL

Ly6g Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
EHMT1/GLP (EHMT1) Human Gene Knockout Kit (CRISPR)
KN414949 1 Kit

EHMT1/GLP (EHMT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF568 conjugate, 0.1mg/mL
BNC682899-500 1x 500 µL

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704383 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details