Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5D, Human (His)

ATP5D Protein, a vital component of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. As part of the F (1) domain and central stalk, ATP5D contributes to ATP hydrolysis through a rotary mechanism. The ATP synthase complex, involving ATP5D, is pivotal for cellular energy production via ATP synthesis. ATP5D Protein, Human (His) is the recombinant human-derived ATP5D protein, expressed by E. coli , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5d-protein-human-his.html

Purity

95.00

Smiles

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Molecular Formula

513 (Gene_ID) P30049 (A23-E168) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C10orf68 (CCDC7) activation kit by CRISPRa
GA112593 1 Kit

Human C10orf68 (CCDC7) activation kit by CRISPRa

Sign In for Pricing
View Details
ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]
TA502776AM 100 µL

ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF594 conjugate, 0.1mg/mL
BNC941712-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF594 conjugate, 0.1mg/mL
BNC941986-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diphacinone-d4 (indanedione-4,5,6,7-d4)
TRC-D486961-1MG 1 mg

Diphacinone-d4 (indanedione-4,5,6,7-d4)

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF740 conjugate, 0.1mg/mL
BNC740045-500 1x 500 µL

Bcl-2 (100/D5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details