Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-alpha/CXCL1, Human (CHO)

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Human (CHO) is produced in CHO cells, and consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-alpha/CXCL1 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-human-cho.html

Purity

98.0

Smiles

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Molecular Formula

2919 (Gene_ID) P09341 (A35-N107) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Bayo J, et al. IL-8, GRO and MCP-1 produced by hepatocellular carcinoma microenvironment determine the migratory capacity of human bone marrow-derived mesenchymal stromal cells without affecting tumor aggressiveness. Oncotarget. 2016 Jun 25;8 (46) :80235-80248.|[2]Hou SM, et al. CXCL1 contributes to IL-6 expression in osteoarthritis and rheumatoid arthritis synovial fibroblasts by CXCR2, c-Raf, MAPK, and AP-1 pathway. Arthritis Res Ther. 2020 Oct 21;22 (1) :251.|[3]Matsuo Y, et al. CXC‐chemokine/CXCR2 biological axis promotes angiogenesis in vitro and in vivo in pancreatic cancer[J]. International journal of cancer, 2009 Feb, 125 (5) : 1027-1037.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Membrane (NM97), CF640R conjugate, 0.1mg/mL
BNC400097-500 1x 500 µL

Nuclear Membrane (NM97), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker), 1mg/mL
BNUM1675-50 1x 50 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker), 1mg/mL

Sign In for Pricing
View Details
Human TIMP1, Tag Free
HA211003-01 Inquire

Human TIMP1, Tag Free

Sign In for Pricing
View Details
Human TIMP1, Tag Free
HA211003-02 50 µg

Human TIMP1, Tag Free

Sign In for Pricing
View Details
Human TIMP1, Tag Free
HA211003-03 100 µg

Human TIMP1, Tag Free

Sign In for Pricing
View Details
Recombinant UBE2C Antibody
RC-5960-01 50 μL

Recombinant UBE2C Antibody

Sign In for Pricing
View Details