Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-alpha/CXCL1, Human (CHO)

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Human (CHO) is produced in CHO cells, and consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-alpha/CXCL1 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-human-cho.html

Purity

98.0

Smiles

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Molecular Formula

2919 (Gene_ID) P09341 (A35-N107) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Bayo J, et al. IL-8, GRO and MCP-1 produced by hepatocellular carcinoma microenvironment determine the migratory capacity of human bone marrow-derived mesenchymal stromal cells without affecting tumor aggressiveness. Oncotarget. 2016 Jun 25;8 (46) :80235-80248.|[2]Hou SM, et al. CXCL1 contributes to IL-6 expression in osteoarthritis and rheumatoid arthritis synovial fibroblasts by CXCR2, c-Raf, MAPK, and AP-1 pathway. Arthritis Res Ther. 2020 Oct 21;22 (1) :251.|[3]Matsuo Y, et al. CXC‐chemokine/CXCR2 biological axis promotes angiogenesis in vitro and in vivo in pancreatic cancer[J]. International journal of cancer, 2009 Feb, 125 (5) : 1027-1037.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluorocinnamic Acid
TRC-F588643-50G 50 g

2-Fluorocinnamic Acid

Sign In for Pricing
View Details
Potassium Citrate Monobasic
TRC-P698710-50G 50 g

Potassium Citrate Monobasic

Sign In for Pricing
View Details
CD64 (10.1), CF640R conjugate, 0.1mg/mL
BNC402846-500 1x 500 µL

CD64 (10.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Optitrol HIV p24
SR11103 4x 2.5 mL

Optitrol HIV p24

Sign In for Pricing
View Details
PGLS Antibody
8C14200-AAT 50 µg

PGLS Antibody

Sign In for Pricing
View Details
SynCAM (CADM1) (NM_001098517) Human Over-expression Lysate
LY420615 100 µg

SynCAM (CADM1) (NM_001098517) Human Over-expression Lysate

Sign In for Pricing
View Details