Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-alpha/CXCL1, Human (CHO)

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Human (CHO) is produced in CHO cells, and consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-alpha/CXCL1 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-human-cho.html

Purity

98.0

Smiles

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Molecular Formula

2919 (Gene_ID) P09341 (A35-N107) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Bayo J, et al. IL-8, GRO and MCP-1 produced by hepatocellular carcinoma microenvironment determine the migratory capacity of human bone marrow-derived mesenchymal stromal cells without affecting tumor aggressiveness. Oncotarget. 2016 Jun 25;8 (46) :80235-80248.|[2]Hou SM, et al. CXCL1 contributes to IL-6 expression in osteoarthritis and rheumatoid arthritis synovial fibroblasts by CXCR2, c-Raf, MAPK, and AP-1 pathway. Arthritis Res Ther. 2020 Oct 21;22 (1) :251.|[3]Matsuo Y, et al. CXC‐chemokine/CXCR2 biological axis promotes angiogenesis in vitro and in vivo in pancreatic cancer[J]. International journal of cancer, 2009 Feb, 125 (5) : 1027-1037.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TSC2 Antibody [DyLight 405]
NB200-200V 0.1 mL

Rabbit Polyclonal TSC2 Antibody [DyLight 405]

Sign In for Pricing
View Details
RAD51C (DNA Repair Protein RAD51 Homolog 3, R51H3, RAD51 Homolog C, RAD51-like Protein 2, MGC104277, RAD51L2) (MaxLight 405) discontinued
132265-ML405 100 µL

RAD51C (DNA Repair Protein RAD51 Homolog 3, R51H3, RAD51 Homolog C, RAD51-like Protein 2, MGC104277, RAD51L2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human Alkaline phosphatase, placental type, ALPP ELISA KIT
ELI-04040h 96 Tests

Human Alkaline phosphatase, placental type, ALPP ELISA KIT

Sign In for Pricing
View Details
USP5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
49335124 3x 1.0µg DNA

USP5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
C6orf57 Polyclonal Antibody, Cy5 Conjugated
bs-15249R-Cy5 100 µL

C6orf57 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Pig EGF Protein, N-GST & C-His
AP97940 50 µg

Recombinant Pig EGF Protein, N-GST & C-His

Sign In for Pricing
View Details