Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecO, E.coli (His-SUMO)

RecO protein, a crucial participant in DNA repair and the RecF pathway, operates as a monomer, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination. Its monomeric form underscores its singular involvement, highlighting its significance in orchestrating cellular responses to DNA damage and recombination. RecO Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecO protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

RecO Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reco-protein-e-coli-his-sumo.html

Purity

98.0

Smiles

MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE

Molecular Formula

947038 (Gene_ID) P0A7H3 (M1-E242) (Accession)

Molecular Weight

Approximately 43.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human ZNF581 Pre-designed siRNA Set B
SI018924B 1 Each

Human ZNF581 Pre-designed siRNA Set B

Ask
View Details
Rabbit anti-Enterobacteria phage T2 (Bacteriophage T2) ALT Polyclonal Antibody
MBS7193392 Inquire

Rabbit anti-Enterobacteria phage T2 (Bacteriophage T2) ALT Polyclonal Antibody

Ask
View Details
Mouse anti Keratin 18 Monoclonal Antibody
MBS461016-01 0.1 mg

Mouse anti Keratin 18 Monoclonal Antibody

Ask
View Details
Mouse anti Keratin 18 Monoclonal Antibody
MBS461016-02 5x 0.1 mg

Mouse anti Keratin 18 Monoclonal Antibody

Ask
View Details
STAC (SH3 and Cysteine-rich Domain-containing Protein, Src Homology 3 and Cysteine-rich Domain-containing Protein, FLJ32331) (MaxLight 750) discontinued
133910-ML750 100 µL

STAC (SH3 and Cysteine-rich Domain-containing Protein, Src Homology 3 and Cysteine-rich Domain-containing Protein, FLJ32331) (MaxLight 750) discontinued

Ask
View Details