Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Leghemoglobin A (LBA)

Product Specifications

Product Name Alternative

Nodulin-2; N-2

Abbreviation

Recombinant Glycine max LBA protein

Gene Name

LBA

UniProt

P02238

Expression Region

2-144aa

Organism

Glycine max (Soybean) (Glycine hispida)

Target Sequence

VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Provides oxygen to the bacteroids. This role is essential for symbiotic nitrogen fixation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Uncharacterized Protein C17orf99 (C17ORF99) ELISA Kit
MBS9921778-01 48 Well

Monkey Uncharacterized Protein C17orf99 (C17ORF99) ELISA Kit

Sign In for Pricing
View Details
Monkey Uncharacterized Protein C17orf99 (C17ORF99) ELISA Kit
MBS9921778-02 96 Well

Monkey Uncharacterized Protein C17orf99 (C17ORF99) ELISA Kit

Sign In for Pricing
View Details
Monkey Uncharacterized Protein C17orf99 (C17ORF99) ELISA Kit
MBS9921778-03 5x 96 Well

Monkey Uncharacterized Protein C17orf99 (C17ORF99) ELISA Kit

Sign In for Pricing
View Details
Monkey Uncharacterized Protein C17orf99 (C17ORF99) ELISA Kit
MBS9921778-04 10x 96 Well

Monkey Uncharacterized Protein C17orf99 (C17ORF99) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal Complement C6 Antibody (037) [DyLight 755]
NBP2-90102IR 0.1 mL

Rabbit Monoclonal Complement C6 Antibody (037) [DyLight 755]

Sign In for Pricing
View Details
Probable E3 ubiquitin-protein ligase HECTD2 (HECTD2) Mouse ELISA Kit
G1068 96 Tests

Probable E3 ubiquitin-protein ligase HECTD2 (HECTD2) Mouse ELISA Kit

Sign In for Pricing
View Details