TNF RI/TNFRSF1A, Mouse
TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Mouse is expressed by E. coli and has a transmembrane region (I22-A212) [1].
Product Specifications
Product Name Alternative
TNF RI/TNFRSF1A Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tnf-ri-tnfrsf1a-protein-mouse.html
Purity
95.98
Smiles
IHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA
Molecular Formula
21937 (Gene_ID) P25118 (I22-A212) (Accession)
Molecular Weight
20-25 kDa
References & Citations
[1]Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10 (1) :45-65.|[2]Fu Q, et, al. miR-29a up-regulation in AR42J cells contributes to apoptosis via targeting TNFRSF1A gene. World J Gastroenterol. 2016 May 28;22 (20) :4881-90.|[3]Zhou S, et, al. Bioinformatics Analysis Identifies TNFRSF1A as a Biomarker of Liver Injury in Sepsis TNFRSF1A is a Biomarker for Septic Liver Injury. Genet Res (Camb) . 2022 Oct 15;2022:1493744.|[4]Egusquiaguirre SP, et, al. The STAT3 Target Gene TNFRSF1A Modulates the NF-κB Pathway in Breast Cancer Cells. Neoplasia. 2018 May;20 (5) :489-498.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
140539 200 µL
Granzyme M (GZMM, Hu-Met-1, LMET1, MET1, Met-1 Serine Protease, Met-ase, Natural Killer Cell Granular Protease)
Sign In for Pricing
View Details ![Trichomonas vaginalis Matched Antibody Pair Set [Z01LS-0722-LS577]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
Z01LS-0722-LS577 5 Plates
Trichomonas vaginalis Matched Antibody Pair Set [Z01LS-0722-LS577]
Sign In for Pricing
View Details ![Mouse Monoclonal ABO, Blood Group A Antigen Antibody (VA4-20B) [mFluor Violet 610 SE]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-50485MFV610 0.1 mL
Mouse Monoclonal ABO, Blood Group A Antigen Antibody (VA4-20B) [mFluor Violet 610 SE]
Sign In for Pricing
View Details 
MR209529L3V 200 µL
F11 (NM_028066) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details