Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L-Selectin/CD62L, Rat (HEK293, His)

L-selectin/CD62L is a calcium-dependent lectin that binds adjacent glycoproteins to allow lymphocyte adhesion to endothelial cells in peripheral lymph nodes. This encourages leukocytes to bind and roll within endothelial tissue. L-Selectin/CD62L Protein, Rat (HEK293, His) is the recombinant rat-derived L-Selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

L-Selectin/CD62L Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-selectin-cd62l-protein-rat-hek293-his.html

Purity

98.0

Smiles

WTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTKRSFSKIKEGDYN

Molecular Formula

29259 (Gene_ID) P30836 (W39-N332) (Accession)

Molecular Weight

Approximately 43-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-500 1x 500 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details