Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L-Selectin/CD62L, Rat (HEK293, His)

L-selectin/CD62L is a calcium-dependent lectin that binds adjacent glycoproteins to allow lymphocyte adhesion to endothelial cells in peripheral lymph nodes. This encourages leukocytes to bind and roll within endothelial tissue. L-Selectin/CD62L Protein, Rat (HEK293, His) is the recombinant rat-derived L-Selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

L-Selectin/CD62L Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/l-selectin-cd62l-protein-rat-hek293-his.html

Purity

98.0

Smiles

WTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTKRSFSKIKEGDYN

Molecular Formula

29259 (Gene_ID) P30836 (W39-N332) (Accession)

Molecular Weight

Approximately 43-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4D CytoSection
TS412410P5 25 Slides

PDE4D CytoSection

Sign In for Pricing
View Details
EVC Polyclonal Conjugated Antibody
MBS9439627-01 0.1 mL (Biotin)

EVC Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
EVC Polyclonal Conjugated Antibody
MBS9439627-02 0.1 mL (AF350)

EVC Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
EVC Polyclonal Conjugated Antibody
MBS9439627-03 0.1 mL (AF405)

EVC Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
EVC Polyclonal Conjugated Antibody
MBS9439627-04 0.1 mL (AF488)

EVC Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
EVC Polyclonal Conjugated Antibody
MBS9439627-05 0.1 mL (AF555)

EVC Polyclonal Conjugated Antibody

Sign In for Pricing
View Details