Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAML/AMICA, Mouse (HEK293, Fc)

JAML/AMICA proteins are predicted to have integrin-binding and homodimerization activities, regulate gamma-delta T cell activation and promote epithelial cell proliferation in wound healing. It mainly exists in the plasma membrane, is an ortholog of human JAML, and is involved in cell adhesion. JAML/AMICA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived JAML/AMICA protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

JAML/AMICA Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jaml-amica-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

QGLPGLTVSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPKDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGNQL

Molecular Formula

270152 (Gene_ID) Q80UL9/NP_001005421.3 (Q21-L281) (Accession)

Molecular Weight

Approximately 56.5 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF1 rabbit polyclonal antibody, Biotin
PP1020B1 25 µg

IGF1 rabbit polyclonal antibody, Biotin

Sign In for Pricing
View Details
Anti-Human CD20/MS4A1 Antibody (SAA1414), APC
FHC90733 100 Tests

Anti-Human CD20/MS4A1 Antibody (SAA1414), APC

Sign In for Pricing
View Details
Kanamycin (sulphate) powder, 50 g
BS-AB17.04050P 50 g

Kanamycin (sulphate) powder, 50 g

Sign In for Pricing
View Details
NT5C Antibody
61-294 200 µL

NT5C Antibody

Sign In for Pricing
View Details
Homologous-pairing protein 2 homolog (PSMC3IP) Rat ELISA Kit
E1219 96 Tests

Homologous-pairing protein 2 homolog (PSMC3IP) Rat ELISA Kit

Sign In for Pricing
View Details
Propargyl-PEG3-NH-Boc
HY-W855790 1 Each

Propargyl-PEG3-NH-Boc

Sign In for Pricing
View Details