Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR2/ASGPR2, Mouse (His-SUMO)

ASGR2/ASGPR2 proteins are critical in cellular processes, mediating the endocytosis of desialylated plasma glycoproteins. It recognizes terminal galactose and N-acetylgalactosamine, promotes ligand internalization, and forms complexes that are transported to sorting organelles. ASGR2/ASGPR2 Protein, Mouse (His-SUMO) is the recombinant mouse-derived ASGR2/ASGPR2 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ASGR2/ASGPR2 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr2-protein-mouse-his-sumo.html

Smiles

QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Molecular Formula

11890 (Gene_ID) P24721 (Q80-H301) (Accession)

Molecular Weight

Approximately 45.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanopsin (OPN4) (NM_001030015) Human Over-expression Lysate
LY422235 100 µg

Melanopsin (OPN4) (NM_001030015) Human Over-expression Lysate

Sign In for Pricing
View Details
HIF-1 alpha (HIF1A) (NM_181054) Human Over-expression Lysate
LY403613 100 µg

HIF-1 alpha (HIF1A) (NM_181054) Human Over-expression Lysate

Sign In for Pricing
View Details
BTG2 Mouse Monoclonal Antibody [Clone ID: OTI2F3]
CF808150 100 µg

BTG2 Mouse Monoclonal Antibody [Clone ID: OTI2F3]

Sign In for Pricing
View Details
ATP8A2 (N-term) Rabbit Polyclonal Antibody
AP50308PU-N 400 µL

ATP8A2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UP-01 25 µg

PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UP-02 100 µg

PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details