Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR2/ASGPR2, Mouse (His-SUMO)

ASGR2/ASGPR2 proteins are critical in cellular processes, mediating the endocytosis of desialylated plasma glycoproteins. It recognizes terminal galactose and N-acetylgalactosamine, promotes ligand internalization, and forms complexes that are transported to sorting organelles. ASGR2/ASGPR2 Protein, Mouse (His-SUMO) is the recombinant mouse-derived ASGR2/ASGPR2 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ASGR2/ASGPR2 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr2-protein-mouse-his-sumo.html

Smiles

QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Molecular Formula

11890 (Gene_ID) P24721 (Q80-H301) (Accession)

Molecular Weight

Approximately 45.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rgs2 Mouse Gene Knockout Kit (CRISPR)
KN514736 1 Kit

Rgs2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pirh2 (RCHY1) (NM_015436) Human Over-expression Lysate
LY402435 100 µg

Pirh2 (RCHY1) (NM_015436) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluorescein-Cadaverine Dihydrochloride
TRC-F485450-50MG 50 mg

Fluorescein-Cadaverine Dihydrochloride

Sign In for Pricing
View Details
PRMT5 (NM_001039619) Human Over-expression Lysate
LC422095 20 µg

PRMT5 (NM_001039619) Human Over-expression Lysate

Sign In for Pricing
View Details
TCEAL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G10]
TA807701BM 100 µL

TCEAL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G10]

Sign In for Pricing
View Details
RFX8 Human Gene Knockout Kit (CRISPR)
KN426831 1 Kit

RFX8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details