Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-A, Rabbit (His-SUMO)

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. VEGF-A Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived VEGF-A protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-A Protein, Rabbit (His-SUMO), Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-a-protein-rabbit-his-sumo.html

Purity

90.00

Smiles

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Molecular Formula

/ (Gene_ID) XP_002714743.1 (Y51-R511) (Accession)

Molecular Weight

Approximately 55-66 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLRG1 (2F1) PE
sc-32755 PE 200 µg/mL

KLRG1 (2F1) PE

Sign In for Pricing
View Details
Lentiviral human NBPF1 shRNA (UAS) - Lentiviral human NBPF1 shRNA (UAS, GFP) (25)
GTR15337955 1 Vial

Lentiviral human NBPF1 shRNA (UAS) - Lentiviral human NBPF1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Methyl 3-Methoxy-4-methylbenzoate
455278-01 1 g

Methyl 3-Methoxy-4-methylbenzoate

Sign In for Pricing
View Details
Methyl 3-Methoxy-4-methylbenzoate
455278-02 5 g

Methyl 3-Methoxy-4-methylbenzoate

Sign In for Pricing
View Details
Mouse Monoclonal PPIL6 Antibody (OTI4F2) [Alexa Fluor 488]
NBP2-73578AF488 0.1 mL

Mouse Monoclonal PPIL6 Antibody (OTI4F2) [Alexa Fluor 488]

Sign In for Pricing
View Details
ZBP1 Protein Vector (Mouse) (pPB-N-His)
PV248215 500 ng

ZBP1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details