BMP-7, Human
Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGFβ family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors[1]. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation[2]. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process[1]. BMP-7 also eliminates vascular inflammation, maintains vascular integrity[3], reduces vascular calcification, and stimulates in situ phosphate ossification deposition[4]. The total length of human BMP-7 protein is 431 amino acids (M1-H431), with 4 glycosylation domains. BMP-7 Protein, Human has a total length of 139 amino acids (S293-H431), is expressed in E. coli cells.
Product Specifications
Product Name Alternative
BMP-7 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bmp-7-protein-human.html
Purity
95.00
Smiles
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Molecular Formula
655 (Gene_ID) P18075 (S293-H431) (Accession)
Molecular Weight
Approximately 15.7 kDa
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF640R conjugate, 0.1mg/mL
