Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-7, Human

Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGFβ family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors[1]. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation[2]. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process[1]. BMP-7 also eliminates vascular inflammation, maintains vascular integrity[3], reduces vascular calcification, and stimulates in situ phosphate ossification deposition[4]. The total length of human BMP-7 protein is 431 amino acids (M1-H431), with 4 glycosylation domains. BMP-7 Protein, Human has a total length of 139 amino acids (S293-H431), is expressed in E. coli cells.

Product Specifications

Product Name Alternative

BMP-7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-7-protein-human.html

Purity

95.00

Smiles

STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Molecular Formula

655 (Gene_ID) P18075 (S293-H431) (Accession)

Molecular Weight

Approximately 15.7 kDa

References & Citations

[1]Sun R, et al. Expression of BMP-7 in cervical cancer and inhibition of epithelial‑mesenchymal transition by BMP-7 knockdown in HeLa cells. Int J Mol Med. 2020 May;45 (5) :1417-1424.|[2]Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9 (3) :a022095.|[3]Dorai H, et al. Bone morphogenetic protein-7 (osteogenic protein-1) inhibits smooth muscle cell proliferation and stimulates the expression of markers that are characteristic of SMC phenotype in vitro. J Cell Physiol. 2000 Jul;184 (1) :37-45.|[4]Mathew S, et al. Function and effect of bone morphogenetic protein-7 in kidney bone and the bone-vascular links in chronic kidney disease. Eur J Clin Invest. 2006 Aug;36 Suppl 2:43-50.|[5]Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.|[6]Xu RH, et al. BMP4 initiates human embryonic stem cell differentiation to trophoblast. Nat Biotechnol. 2002 Dec;20 (12) :1261-4.|[7]Beck HN, et al. Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons. BMC Neurosci. 2001;2:12.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2Y4 (P2RY4) (NM_002565) Human Over-expression Lysate
LY400911 100 µg

P2Y4 (P2RY4) (NM_002565) Human Over-expression Lysate

Sign In for Pricing
View Details
PAX6 (PAX6/498), CF640R conjugate, 0.1mg/mL
BNC400498-500 1x 500 µL

PAX6 (PAX6/498), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MPP1 (NM_001166461) Human Over-expression Lysate
LC433095 20 µg

MPP1 (NM_001166461) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS705328 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Tide Quencher™ 8WS maleimide [TQ8WS maleimide]
2134-AAT 1 mg

Tide Quencher™ 8WS maleimide [TQ8WS maleimide]

Sign In for Pricing
View Details
Mouse IL-1 alpha Recombinant Rabbit monoclonal Antibody
HA723526 100 µL

Mouse IL-1 alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details