Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Human

FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

Product Specifications

Product Name Alternative

FGF-23 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-human.html

Purity

95.0

Smiles

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Molecular Formula

8074 (Gene_ID) Q9GZV9 (Y25-F251) (Accession)

Molecular Weight

Approximately 25.3 kDa

References & Citations

[1]Guibert M, et al. Fibroblast-growth factor 23 promotes terminal differentiation of ATDC5 cells. PLoS One. 2017 Apr 13;12 (4) :e0174969.|[2]Ohata Y, et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J Bone Miner Res. 2014 Jul;29 (7) :1627-38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gspt1 siRNA Oligos set (Mouse)
22740174 3x 5 nmol

Gspt1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
IL-16 Rabbit pAb, Pacific Blue conjugated
orb2849360 100 µL

IL-16 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
VSX1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2621807 1.0 µg DNA

VSX1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Canine Lymphocyte function associated antigen 3 ELISA kit
GTR10448020 96 Well

Canine Lymphocyte function associated antigen 3 ELISA kit

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1192016-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1192016-02 0.1 mg (E-Coli)

Recombinant Bacillus anthracis Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details