Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Human

FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

Product Specifications

Product Name Alternative

FGF-23 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-human.html

Purity

95.0

Smiles

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Molecular Formula

8074 (Gene_ID) Q9GZV9 (Y25-F251) (Accession)

Molecular Weight

Approximately 25.3 kDa

References & Citations

[1]Guibert M, et al. Fibroblast-growth factor 23 promotes terminal differentiation of ATDC5 cells. PLoS One. 2017 Apr 13;12 (4) :e0174969.|[2]Ohata Y, et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J Bone Miner Res. 2014 Jul;29 (7) :1627-38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMMP2L Antibody - C-terminal region : HRP (ARP60563_P050-HRP)
ARP60563_P050-HRP 100 µL

IMMP2L Antibody - C-terminal region : HRP (ARP60563_P050-HRP)

Sign In for Pricing
View Details
ETFA Mouse Monoclonal Antibody
AMM82794-01 1 Each

ETFA Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ETFA Mouse Monoclonal Antibody
AMM82794-02 50 µL

ETFA Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ETFA Mouse Monoclonal Antibody
AMM82794-03 100 µL

ETFA Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SSH3 Antibody
CSB-PA593063 100 µL

SSH3 Antibody

Sign In for Pricing
View Details
Valeric acid, 4-hydroxy-, (5-nitrofurfurylidene)hydrazide
MBS5784505 Inquire

Valeric acid, 4-hydroxy-, (5-nitrofurfurylidene)hydrazide

Sign In for Pricing
View Details