Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product Specifications

Product Name Alternative

Pre-GP-C

Abbreviation

Recombinant Mopeia virus GPC protein, partial

Gene Name

GPC

UniProt

P19240

Expression Region

59-430aa

Organism

Mopeia virus (MOPV)

Target Sequence

SIYKDNYEFFSLDLDMSSLNATMPLSCSKNNSHHYIQVGNETGLELTLTNTSIINHKFCNLSDAHRRNLYDKALMSILTTFHLSIPDFNQYEAMSCDFNGGKISVQYNLSHSNYVDAGNHCGTIANGIMDVFRRMYWSTSLSVASDISGTQCIQTDYKYLIIQNTSWEDHCMFSRPSPMGFLSLLSQRTRNFYISRRLLGLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFNKQAISKLRSEVQQSINLINKAVNALINDQLVMRNHLRDLMGIPYCNYSKFWYLNDTRTGRTSLPKCWLVTNGSYLNETQFSTEIEQEANNMFTDMLRKEYEKRQSTTPLGLVD

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Functions as a cleaved signal peptide that is retained as the third component of the GP complex (GP-C) . Helps to stabilize the spike complex in its native conformation. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of G1 and G2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.UniRule Annotation Glycoprotein G1

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

71.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIL2 Antibody
KC-2835-01 50 μL

PPIL2 Antibody

Sign In for Pricing
View Details
PPIL2 Antibody
KC-2835-02 100 µL

PPIL2 Antibody

Sign In for Pricing
View Details
PPIL2 Antibody
KC-2835-03 1 mL

PPIL2 Antibody

Sign In for Pricing
View Details
ACCSL (NM_001031854) Human Over-expression Lysate
LC422209 20 µg

ACCSL (NM_001031854) Human Over-expression Lysate

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), 0.2mg/mL
BNUB2924-100 1x 100 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR560616 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details