Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin B, Rat (HEK293, His)

Cathepsin B is a lysosomal cysteine protease that plays a role in intracellular protein catabolism. Cathepsin B mediates JNK signaling pathway to regulate the migration of glioma initiation cells. Cathepsin B is involved in the pathology of chronic inflammatory diseases of the airway and joints, as well as cancer and pancreatitis. Cathepsin B Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin B Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-b-protein-rat-hek293-his.html

Purity

98.00

Smiles

HDKPSFHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF

Molecular Formula

64529 (Gene_ID) Q6IN22 (H18-F339) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meteorin shRNA Plasmid (h)
sc-93205-SH 20 µg

Meteorin shRNA Plasmid (h)

Sign In for Pricing
View Details
MLH1 (Human Mul L Homologue, Familial Nonpolyposis Colin Cancer Type 2, COCA2, Colon Cancer Type 2, COCA2, FCC2, HNPCC, HNPCC2, MGC5172, hMLH1) (Biotin)
MBS6426806-01 0.1 mL

MLH1 (Human Mul L Homologue, Familial Nonpolyposis Colin Cancer Type 2, COCA2, Colon Cancer Type 2, COCA2, FCC2, HNPCC, HNPCC2, MGC5172, hMLH1) (Biotin)

Sign In for Pricing
View Details
MLH1 (Human Mul L Homologue, Familial Nonpolyposis Colin Cancer Type 2, COCA2, Colon Cancer Type 2, COCA2, FCC2, HNPCC, HNPCC2, MGC5172, hMLH1) (Biotin)
MBS6426806-02 5x 0.1 mL

MLH1 (Human Mul L Homologue, Familial Nonpolyposis Colin Cancer Type 2, COCA2, Colon Cancer Type 2, COCA2, FCC2, HNPCC, HNPCC2, MGC5172, hMLH1) (Biotin)

Sign In for Pricing
View Details
Zinc finger protein 828 (ZNF828) Mouse ELISA Kit
I3965 96 Tests

Zinc finger protein 828 (ZNF828) Mouse ELISA Kit

Sign In for Pricing
View Details
PLZF Polyclonal Antibody
RD90389A-01 60 μL

PLZF Polyclonal Antibody

Sign In for Pricing
View Details
PLZF Polyclonal Antibody
RD90389A-02 120 μL

PLZF Polyclonal Antibody

Sign In for Pricing
View Details