HABP1/C1QBP, Mouse (His)
The HABP1/C1QBP proteins are part of the MAM33 family, related to a unique family of proteins known for unique characteristics and functions. Among the MAM33 family, HABP1 may play an important role in related cellular processes, but its specific function still needs to be explored. HABP1/C1QBP Protein, Mouse (His) is the recombinant mouse-derived HABP1/C1QBP protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
HABP1/C1QBP Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/habp1-c1qbp-protein-mouse-his.html
Purity
95.30
Smiles
LHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQATGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKNQ
Molecular Formula
12261 (Gene_ID) Q8R5L1 (L72-Q279) (Accession)
Molecular Weight
Approximately 32 kDa.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940977-100 1x 100 µL
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400096-100 1x 100 µL
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 