Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (C-His)

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (C-His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-c-his.html

Purity

95.0

Smiles

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) P23297 (M1-S94) (Accession)

Molecular Weight

Approximately 10.03 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Smyd1 shRNA (UAS) - Lentiviral mouseSmyd1 shRNA (UAS, GFP) (25)
GTR15285116 1 Vial

Lentiviral mouse Smyd1 shRNA (UAS) - Lentiviral mouseSmyd1 shRNA (UAS, GFP) (25)

Ask
View Details
MASP-1/3 (Mannose Binding-Lectin [MBL]-Associated Serine Proteases)
298084 100 µg

MASP-1/3 (Mannose Binding-Lectin [MBL]-Associated Serine Proteases)

Ask
View Details
Sox21-set siRNA/shRNA/RNAi Lentivector (Mouse)
45143094 4x 500 ng

Sox21-set siRNA/shRNA/RNAi Lentivector (Mouse)

Ask
View Details
Human ANKRD55 Protein Lysate
MBS137273-01 0.02 mg

Human ANKRD55 Protein Lysate

Ask
View Details
Human ANKRD55 Protein Lysate
MBS137273-02 5x 0.02 mg

Human ANKRD55 Protein Lysate

Ask
View Details
OTU7B, CT (OTUD7B, ZA20D1, OTU domain-containing protein 7B, Cellular zinc finger anti-NF-kappa-B protein, Zinc finger A20 domain-containing protein 1, Zinc finger protein Cezanne) (FITC) discontinued
039534-FITC 200 µL

OTU7B, CT (OTUD7B, ZA20D1, OTU domain-containing protein 7B, Cellular zinc finger anti-NF-kappa-B protein, Zinc finger A20 domain-containing protein 1, Zinc finger protein Cezanne) (FITC) discontinued

Ask
View Details