S100A1, Human (C-His)
S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (C-His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
S100A1 Protein, Human (C-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100a1-protein-human-c-his.html
Purity
95.0
Smiles
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Molecular Formula
6271 (Gene_ID) P23297 (M1-S94) (Accession)
Molecular Weight
Approximately 10.03 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (FITC)
ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (FITC)
