Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (C-His)

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (C-His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-c-his.html

Purity

95.0

Smiles

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) P23297 (M1-S94) (Accession)

Molecular Weight

Approximately 10.03 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Junctional Adhesion Molecule 1 (JAM1) ELISA Kit
MBS451070-01 48 Tests

Human Junctional Adhesion Molecule 1 (JAM1) ELISA Kit

Ask
View Details
Human Junctional Adhesion Molecule 1 (JAM1) ELISA Kit
MBS451070-02 96 Tests

Human Junctional Adhesion Molecule 1 (JAM1) ELISA Kit

Ask
View Details
Human Junctional Adhesion Molecule 1 (JAM1) ELISA Kit
MBS451070-03 5x 96 Tests

Human Junctional Adhesion Molecule 1 (JAM1) ELISA Kit

Ask
View Details
Human Junctional Adhesion Molecule 1 (JAM1) ELISA Kit
MBS451070-04 10x 96 Tests

Human Junctional Adhesion Molecule 1 (JAM1) ELISA Kit

Ask
View Details
SKIV2L2, ID (ATP-dependent Helicase SKIV2L2, Superkiller Viralicidic Activity 2-like 2, KIAA0052) (MaxLight 650) discontinued
S1014-10K2-ML650 100 µL

SKIV2L2, ID (ATP-dependent Helicase SKIV2L2, Superkiller Viralicidic Activity 2-like 2, KIAA0052) (MaxLight 650) discontinued

Ask
View Details
RNPEP (APB, Aminopeptidase B, Arginine Aminopeptidase, Arginyl Aminopeptidase) (PE)
MBS6160000-01 0.1 mL

RNPEP (APB, Aminopeptidase B, Arginine Aminopeptidase, Arginyl Aminopeptidase) (PE)

Ask
View Details