Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (C-His)

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (C-His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-c-his.html

Purity

95.0

Smiles

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) P23297 (M1-S94) (Accession)

Molecular Weight

Approximately 10.03 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)
MBS1250835-01 0.02 mg (E-Coli)

Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)

Ask
View Details
Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)
MBS1250835-02 0.02 mg (Yeast)

Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)

Ask
View Details
Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)
MBS1250835-03 0.1 mg (E-Coli)

Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)

Ask
View Details
Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)
MBS1250835-04 0.1 mg (Yeast)

Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)

Ask
View Details
Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)
MBS1250835-05 0.02 mg (Baculovirus)

Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)

Ask
View Details
Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)
MBS1250835-06 0.02 mg (Mammalian-Cell)

Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A (POLR2M)

Ask
View Details