Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (C-His)

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (C-His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-c-his.html

Purity

95.0

Smiles

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) P23297 (M1-S94) (Accession)

Molecular Weight

Approximately 10.03 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF640R conjugate, 0.1mg/mL
BNC401725-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF640R conjugate, 0.1mg/mL
BNC402338-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF740 conjugate, 0.1mg/mL
BNC740960-100 1x 100 µL

MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details