Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRIPT, Human (His)

CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CRIPT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cript-protein-human-his.html

Purity

97.60

Smiles

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Molecular Formula

9419 (Gene_ID) Q9P021 (M1-V101) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSBP Protein Vector (Human) (pPB-N-His)
PV079462 500 ng

FSBP Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
RARα Rabbit pAb
E45R17430N-50 50 µL

RARα Rabbit pAb

Sign In for Pricing
View Details
Mouse Anti Nuclear Antibody HEp2 ELISA kit
GTR10383047 96 Well

Mouse Anti Nuclear Antibody HEp2 ELISA kit

Sign In for Pricing
View Details
ATN1 Protein Vector (Human) (pPM-C-HA)
12651021 500 ng

ATN1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
IL4R (Interleukin 4 Receptor, CD124, IL4RA) (MaxLight 490)
247597-ML490 100 µL

IL4R (Interleukin 4 Receptor, CD124, IL4RA) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Monoclonal ILT1/CD85h/LILRA2 Antibody (600007) [DyLight 405]
FAB6364E 0.1 mL

Mouse Monoclonal ILT1/CD85h/LILRA2 Antibody (600007) [DyLight 405]

Sign In for Pricing
View Details