CRIPT, Human (His)
CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
CRIPT Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cript-protein-human-his.html
Purity
97.60
Smiles
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Molecular Formula
9419 (Gene_ID) Q9P021 (M1-V101) (Accession)
Molecular Weight
Approximately 14 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1664346-01 48 Tests
Human Oxoglutarate Dehydrogenase (OGDH) ELISA Kit
Sign In for Pricing
View Details orb1664346-02 96 Tests
Human Oxoglutarate Dehydrogenase (OGDH) ELISA Kit
Sign In for Pricing
View Details 
KH011-02 each
Anti CML Monoclonal Antibody (Clone No. CMS-10) Peroxidase conjugated
Sign In for Pricing
View Details LV746009 1.0 µg DNA
RNF11P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
MBS6133983-01 0.1 mL
SS18 (Protein SSXT, Protein SYT, Synovial Sarcoma Translocated to X Chromosome Protein, SSXT, SYT, MGC116875) (AP)
Sign In for Pricing
View Details MBS6133983-02 5x 0.1 mL
SS18 (Protein SSXT, Protein SYT, Synovial Sarcoma Translocated to X Chromosome Protein, SSXT, SYT, MGC116875) (AP)
Sign In for Pricing
View Details