CRIPT, Human (His)
CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
CRIPT Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cript-protein-human-his.html
Purity
97.60
Smiles
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Molecular Formula
9419 (Gene_ID) Q9P021 (M1-V101) (Accession)
Molecular Weight
Approximately 14 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EKE61623-01 96 Tests
Mouse EPCAM (Epithelial Cell Adhesion Molecule) ELISA Kit
Sign In for Pricing
View Details EKE61623-02 5x 96 Tests
Mouse EPCAM (Epithelial Cell Adhesion Molecule) ELISA Kit
Sign In for Pricing
View Details DHC33070-01 50 mg
Tert-Butyl 3-hydroxy-3- (hydroxymethyl) azetidine-1-carboxylate
Sign In for Pricing
View Details DHC33070-02 0.5 g
Tert-Butyl 3-hydroxy-3- (hydroxymethyl) azetidine-1-carboxylate
Sign In for Pricing
View Details