Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRIPT, Human (His)

CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CRIPT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cript-protein-human-his.html

Purity

97.60

Smiles

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Molecular Formula

9419 (Gene_ID) Q9P021 (M1-V101) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sun1 (NM_024451) Mouse Tagged Lenti ORF Clone
MR211159L4 10 µg

Sun1 (NM_024451) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Vcam1 (NM_011693) Mouse Tagged ORF Clone Lentiviral Particle
MR227630L4V 200 µL

Vcam1 (NM_011693) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Thyroxine antibody
MBS530483 10 mg

Thyroxine antibody

Sign In for Pricing
View Details
CPEB3 Rabbit pAb, PerCP-Cy7 conjugated
orb2868324 100 µL

CPEB3 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
CD11c (ITGAX) Rabbit Monoclonal Antibody
TA422315 100 µL

CD11c (ITGAX) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Alpha-Synuclein Polyclonal Antibody AP Conjugated
C90370AP 100 µL

Alpha-Synuclein Polyclonal Antibody AP Conjugated

Sign In for Pricing
View Details