Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRIPT, Human (His)

CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CRIPT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cript-protein-human-his.html

Purity

97.60

Smiles

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Molecular Formula

9419 (Gene_ID) Q9P021 (M1-V101) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Tumor necrosis factor receptor superfamily member 6 (Fas)
orb2902660-01 20 µg

Recombinant Mouse Tumor necrosis factor receptor superfamily member 6 (Fas)

Sign In for Pricing
View Details
Recombinant Mouse Tumor necrosis factor receptor superfamily member 6 (Fas)
orb2902660-02 100 µg

Recombinant Mouse Tumor necrosis factor receptor superfamily member 6 (Fas)

Sign In for Pricing
View Details
[KO Validated] MANF Rabbit pAb (APR29489N)
APR29489N-01 50 µL

[KO Validated] MANF Rabbit pAb (APR29489N)

Sign In for Pricing
View Details
[KO Validated] MANF Rabbit pAb (APR29489N)
APR29489N-02 100 µL

[KO Validated] MANF Rabbit pAb (APR29489N)

Sign In for Pricing
View Details
[KO Validated] MANF Rabbit pAb (APR29489N)
APR29489N-03 200 µL

[KO Validated] MANF Rabbit pAb (APR29489N)

Sign In for Pricing
View Details
CDCA2 Antibody
orb683789 100 µL

CDCA2 Antibody

Sign In for Pricing
View Details