Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRIPT, Human (His)

CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CRIPT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cript-protein-human-his.html

Purity

97.60

Smiles

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Molecular Formula

9419 (Gene_ID) Q9P021 (M1-V101) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Collagen IV COL4A1 Antibody Picoband® (monoclonal, 3G3)
M01411 100 µg/Vial

Anti-Collagen IV COL4A1 Antibody Picoband® (monoclonal, 3G3)

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus repF Protein (aa 1-199)
VAng-Cr6135-1mgEcoli 1 mg (E. coli)

Recombinant Staphylococcus Aureus repF Protein (aa 1-199)

Sign In for Pricing
View Details
Rabbit Polyclonal MDGA1 Antibody
NBP1-93712-25ul 25 µL

Rabbit Polyclonal MDGA1 Antibody

Sign In for Pricing
View Details
BMI1 293 Cell Lysate
401436 0.1 mg

BMI1 293 Cell Lysate

Sign In for Pricing
View Details
APOM (Apolipoprotein M, G3a, HSPC336, MGC22400, NG20) (APC)
243422-APC 100 µL

APOM (Apolipoprotein M, G3a, HSPC336, MGC22400, NG20) (APC)

Sign In for Pricing
View Details
Cevidoplenib dimesylate
C01900-01 5 mg

Cevidoplenib dimesylate

Sign In for Pricing
View Details