CRIPT, Human (His)
CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
CRIPT Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cript-protein-human-his.html
Purity
97.60
Smiles
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Molecular Formula
9419 (Gene_ID) Q9P021 (M1-V101) (Accession)
Molecular Weight
Approximately 14 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6358336-01 0.1 mL
TRIM36, ID (TRIM36, RBCC728, RNF98, E3 ubiquitin-protein ligase TRIM36, RING finger protein 98, Tripartite motif-containing protein 36, Zinc-binding protein Rbcc728) (MaxLight 490)
Sign In for Pricing
View Details MBS6358336-02 5x 0.1 mL
TRIM36, ID (TRIM36, RBCC728, RNF98, E3 ubiquitin-protein ligase TRIM36, RING finger protein 98, Tripartite motif-containing protein 36, Zinc-binding protein Rbcc728) (MaxLight 490)
Sign In for Pricing
View Details 
MBS2096067-01 0.1 mL
Biotin-Linked Polyclonal Antibody to Transient Receptor Potential Cation Channel Subfamily C, Member 6 (TRPC6)
Sign In for Pricing
View Details MBS2096067-02 0.2 mL
Biotin-Linked Polyclonal Antibody to Transient Receptor Potential Cation Channel Subfamily C, Member 6 (TRPC6)
Sign In for Pricing
View Details MBS2096067-03 0.5 mL
Biotin-Linked Polyclonal Antibody to Transient Receptor Potential Cation Channel Subfamily C, Member 6 (TRPC6)
Sign In for Pricing
View Details MBS2096067-04 1 mL
Biotin-Linked Polyclonal Antibody to Transient Receptor Potential Cation Channel Subfamily C, Member 6 (TRPC6)
Sign In for Pricing
View Details