Question 1

What is the catalog number for Rat PPDPF siRNA?

Accepted Answer

The catalog number for Rat PPDPF siRNA is abx929371.

Question 2

What sizes are available for Rat PPDPF siRNA?

Accepted Answer

Rat PPDPF siRNA is available in the following size(s): 15 nmol, 30 nmol.

Question 3

How many pack sizes does Rat PPDPF siRNA come in?

Accepted Answer

Rat PPDPF siRNA is available in 2 different pack sizes.

Question 4

Is Rat PPDPF siRNA in stock?

Accepted Answer

Rat PPDPF siRNA is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Accepted Answer

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

Question 6

What host species was used to raise this antibody?

Accepted Answer

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

Question 7

What is the difference between this product and a similar catalogue number?

Accepted Answer

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Rat PPDPF siRNA

Product Specifications

Applications

Notes

Tested Applications

Host or Source

Available Sizes

Frequently Asked Questions

Explore Other Products

4-Bromobenzenesulfonyl Chloride

4-Bromobenzenesulfonyl Chloride

CCL19 Recombinant Antibody, PE-Cy5 Conjugated

CCL19 Recombinant Antibody, PE-Cy5 Conjugated

H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2

H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2