Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stomatin-Like Protein 3 (STOML3) Antibody
abx238348 100 µg

Stomatin-Like Protein 3 (STOML3) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal ALDH1L1 Antibody (ALDH1L1/7969) [DyLight 594]
NBP3-24234DL594 0.1 mL

Mouse Monoclonal ALDH1L1 Antibody (ALDH1L1/7969) [DyLight 594]

Sign In for Pricing
View Details
FRPD3 rabbit pAb
ES16318-01 50 µL

FRPD3 rabbit pAb

Sign In for Pricing
View Details
FRPD3 rabbit pAb
ES16318-02 100 µL

FRPD3 rabbit pAb

Sign In for Pricing
View Details
FLLRN 10mg
A23194-10 10 mg

FLLRN 10mg

Sign In for Pricing
View Details
LCK sgRNA CRISPR Lentivector (Human) (Target 1)
K1201902 1.0 µg DNA

LCK sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details