Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC*Polyclonal  Rabbit Anti-Biotin
CE30513-01 1 mL

FITC*Polyclonal Rabbit Anti-Biotin

Sign In for Pricing
View Details
FITC*Polyclonal  Rabbit Anti-Biotin
CE30513-02 10 mL

FITC*Polyclonal Rabbit Anti-Biotin

Sign In for Pricing
View Details
ASTN1 Protein Vector (Mouse) (pPM-C-His)
PV156857 500 ng

ASTN1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
SLC9A7 (Sodium/Hydrogen Exchanger 7, Solute Carrier Family 9, Subfamily A (NHE7, Cation Proton Antiporter 7), Member 7)
492209 100 µL

SLC9A7 (Sodium/Hydrogen Exchanger 7, Solute Carrier Family 9, Subfamily A (NHE7, Cation Proton Antiporter 7), Member 7)

Sign In for Pricing
View Details
SLC6A16 AAV siRNA Pooled Vector
44253161 1.0 µg

SLC6A16 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MIgM (Membrane IgM) BioAssayTM ELISA Kit (Monkey) discontinued
357313-01 48 Tests

MIgM (Membrane IgM) BioAssayTM ELISA Kit (Monkey) discontinued

Sign In for Pricing
View Details