Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal Anti-CD45RA Clone 4KB5
TA353407L 500 µg

Mouse monoclonal Anti-CD45RA Clone 4KB5

Sign In for Pricing
View Details
GPR116 Antibody
ABD4944 100 µg

GPR116 Antibody

Sign In for Pricing
View Details
Recombinant Clostridium Difficile luxS Protein (aa 1-151)
VAng-Lsx9225-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Difficile luxS Protein (aa 1-151)

Sign In for Pricing
View Details
Human LTA (lipoteichoic acids) QuickTest ELISA Kit
QT-EH3301 96 Tests

Human LTA (lipoteichoic acids) QuickTest ELISA Kit

Sign In for Pricing
View Details
EGFR  polyclonal antibody
BS80274 50ul

EGFR polyclonal antibody

Sign In for Pricing
View Details
Atg14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6734006 1.0 µg DNA

Atg14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details