Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen I alpha2
399352-01 50 µL

Collagen I alpha2

Sign In for Pricing
View Details
Collagen I alpha2
399352-02 100 µL

Collagen I alpha2

Sign In for Pricing
View Details
DNAJB6 (HSJ2, MRJ, MSJ1, DnaJ Homolog Subfamily B Member 6, HHDJ1, Heat Shock Protein J2, HSJ-2, MSJ-1, MGC1152, MGC117297, DKFZp566D0824, FLJ42837) (HRP)
MBS6152185-01 0.1 mL

DNAJB6 (HSJ2, MRJ, MSJ1, DnaJ Homolog Subfamily B Member 6, HHDJ1, Heat Shock Protein J2, HSJ-2, MSJ-1, MGC1152, MGC117297, DKFZp566D0824, FLJ42837) (HRP)

Sign In for Pricing
View Details
DNAJB6 (HSJ2, MRJ, MSJ1, DnaJ Homolog Subfamily B Member 6, HHDJ1, Heat Shock Protein J2, HSJ-2, MSJ-1, MGC1152, MGC117297, DKFZp566D0824, FLJ42837) (HRP)
MBS6152185-02 5x 0.1 mL

DNAJB6 (HSJ2, MRJ, MSJ1, DnaJ Homolog Subfamily B Member 6, HHDJ1, Heat Shock Protein J2, HSJ-2, MSJ-1, MGC1152, MGC117297, DKFZp566D0824, FLJ42837) (HRP)

Sign In for Pricing
View Details
C1QTNF9 Protein Vector (Human) (pPM-N-D-C-His)
PV330269 500 ng

C1QTNF9 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Recombinant Human CST3 (N-6His)
CE75-01 10 µg

Recombinant Human CST3 (N-6His)

Sign In for Pricing
View Details