Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prmt2 siRNA Oligos set (Rat)
37716176 3x 5 nmol

Prmt2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Mouse Fibroblast growth factor 15 Protein, His-SUMO, E.coli-50ug
QP7474-ec-50ug 50ug

Recombinant Mouse Fibroblast growth factor 15 Protein, His-SUMO, E.coli-50ug

Sign In for Pricing
View Details
GJA9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0860305 3x 1.0 µg

GJA9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
EIF4E1B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0669705 3x 1.0 µg

EIF4E1B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Rat Tropomodulin-1 (Tmod1)
MBS962682-01 0.02 mg (E-Coli)

Recombinant Rat Tropomodulin-1 (Tmod1)

Sign In for Pricing
View Details
Recombinant Rat Tropomodulin-1 (Tmod1)
MBS962682-02 0.02 mg (Yeast)

Recombinant Rat Tropomodulin-1 (Tmod1)

Sign In for Pricing
View Details