Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD17 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
38407061 1.0 µg DNA

RAD17 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
WDR6 sgRNA CRISPR Lentivector set (Human)
K2628801 3x 1.0 µg

WDR6 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral mouse Pgm3 shRNA (UAS) - Lentiviral mousePgm3 shRNA (UAS, GFP) (25)
GTR15228944 1 Vial

Lentiviral mouse Pgm3 shRNA (UAS) - Lentiviral mousePgm3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PSMC5 Human shRNA Plasmid Kit (Locus ID 5705)
TR310102 1 Kit

PSMC5 Human shRNA Plasmid Kit (Locus ID 5705)

Sign In for Pricing
View Details
FOXI3 sgRNA CRISPR Lentivector (Human) (Target 3)
K0797004 1.0 µg DNA

FOXI3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (MaxLight 750)
MBS6241345-01 0.1 mL

YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (MaxLight 750)

Sign In for Pricing
View Details