Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2AD (H2AC7) (NM_021065) Human Tagged ORF Clone Lentiviral Particle
RC217009L3V 200 µL

HIST1H2AD (H2AC7) (NM_021065) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Laminin alpha 5 Recombinant Rabbit mAb
BS48129-01 50 µL

Laminin alpha 5 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Laminin alpha 5 Recombinant Rabbit mAb
BS48129-02 100 µL

Laminin alpha 5 Recombinant Rabbit mAb

Sign In for Pricing
View Details
USP9YP5 Protein Vector (Human) (pPM-C-HA)
PV142476 500 ng

USP9YP5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Orchid Multiplication Medium
B2023125 1 L

Orchid Multiplication Medium

Sign In for Pricing
View Details
Alpha-Synuclein Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8123661-01 0.1 mL

Alpha-Synuclein Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details