Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Serum (10%) in PBS, pH 7.4
30611284-2 250 ml

Sheep Serum (10%) in PBS, pH 7.4

Sign In for Pricing
View Details
Staphylococcus aureus Enterotoxin A Antibody
abx022242 1 mg

Staphylococcus aureus Enterotoxin A Antibody

Sign In for Pricing
View Details
Lentiviral mouse Eme2 shRNA (UAS) - Lentiviral mouse Eme2 shRNA (UAS, iRFP) (100)
GTR15300366 1 Vial

Lentiviral mouse Eme2 shRNA (UAS) - Lentiviral mouse Eme2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Human SKAR Protein - (Dry Ice)
H00084271-P01-2ug 2 µg

Recombinant Human SKAR Protein - (Dry Ice)

Sign In for Pricing
View Details
LRPAP, Recombinant, Human (LDL Receptor-related Protein-Associated Protein 1, A2MRAP, A2RAP, Alpha-2-macroglobulin receptor-associated protein, Alpha-2-MRAP, HBP44, MGC138272, MRAP, RAP)
MBS635871-01 0.05 mg

LRPAP, Recombinant, Human (LDL Receptor-related Protein-Associated Protein 1, A2MRAP, A2RAP, Alpha-2-macroglobulin receptor-associated protein, Alpha-2-MRAP, HBP44, MGC138272, MRAP, RAP)

Sign In for Pricing
View Details
LRPAP, Recombinant, Human (LDL Receptor-related Protein-Associated Protein 1, A2MRAP, A2RAP, Alpha-2-macroglobulin receptor-associated protein, Alpha-2-MRAP, HBP44, MGC138272, MRAP, RAP)
MBS635871-02 5x 0.05 mg

LRPAP, Recombinant, Human (LDL Receptor-related Protein-Associated Protein 1, A2MRAP, A2RAP, Alpha-2-macroglobulin receptor-associated protein, Alpha-2-MRAP, HBP44, MGC138272, MRAP, RAP)

Sign In for Pricing
View Details