Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Affinity Immunoglobulin Gamma Fc Region Receptor II-B (FCGR2B) Antibody
abx421323-01 50 µg

Low Affinity Immunoglobulin Gamma Fc Region Receptor II-B (FCGR2B) Antibody

Sign In for Pricing
View Details
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-B (FCGR2B) Antibody
abx421323-02 100 µg

Low Affinity Immunoglobulin Gamma Fc Region Receptor II-B (FCGR2B) Antibody

Sign In for Pricing
View Details
TRIM15 Antibody, HRP conjugated
A70719-100UG 100 µg

TRIM15 Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbi! anti-ARHGAP12 Antibody, Affinity Purified
A304-740A 100 µg

Rabbi! anti-ARHGAP12 Antibody, Affinity Purified

Sign In for Pricing
View Details
Falcon Transparent 1um Pet Membrane For 6 Well Plate
353102 48 / PCK

Falcon Transparent 1um Pet Membrane For 6 Well Plate

Sign In for Pricing
View Details
RNF25 (NM_022453) Human Over-expression Lysate
LS064320-100ug 100 µg

RNF25 (NM_022453) Human Over-expression Lysate

Sign In for Pricing
View Details