Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ASTL shRNA (UAS) - Lentiviral human ASTL shRNA (UAS) plasmid
GTR15124231 1 Vial

Lentiviral human ASTL shRNA (UAS) - Lentiviral human ASTL shRNA (UAS) plasmid

Sign In for Pricing
View Details
NOS1AP Protein Vector (Mouse) (pPB-C-His)
PV206118 500 ng

NOS1AP Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin 8 (Defa8), partial
MBS1154028-01 0.05 mg (E-Coli)

Recombinant Mouse Alpha-defensin 8 (Defa8), partial

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin 8 (Defa8), partial
MBS1154028-02 0.2 mg (E-Coli)

Recombinant Mouse Alpha-defensin 8 (Defa8), partial

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin 8 (Defa8), partial
MBS1154028-03 0.5 mg (E-Coli)

Recombinant Mouse Alpha-defensin 8 (Defa8), partial

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin 8 (Defa8), partial
MBS1154028-04 0.05 mg (Baculovirus)

Recombinant Mouse Alpha-defensin 8 (Defa8), partial

Sign In for Pricing
View Details