Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51Q1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1565508 1.0 µg DNA

OR51Q1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit anti-human forkhead box H1 polyclonal Antibody
MBS714850-01 0.1 mL

Rabbit anti-human forkhead box H1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human forkhead box H1 polyclonal Antibody
MBS714850-02 5x 0.1 mL

Rabbit anti-human forkhead box H1 polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF10D Protein Vector (Human) (pPM-C-His)
PV043224 500 ng

TNFRSF10D Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Fast Human Amyloid β 40 /Aβ40 ELISA
TBS3298 96 Well Plate

Fast Human Amyloid β 40 /Aβ40 ELISA

Sign In for Pricing
View Details
Anti-Human CD28 Antibody (15E8#)
MBS1564222-01 0.05 mg

Anti-Human CD28 Antibody (15E8#)

Sign In for Pricing
View Details