Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epb4-1l5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
57019156 3x 1.0 µg DNA

Epb4-1l5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rhox8 Mouse shRNA Plasmid (Locus ID 434768)
TR508835 1 Kit

Rhox8 Mouse shRNA Plasmid (Locus ID 434768)

Sign In for Pricing
View Details
Dog Tumor Necrosis Factor Alpha, Active Protein
RPU60320-01 50 µg

Dog Tumor Necrosis Factor Alpha, Active Protein

Sign In for Pricing
View Details
Dog Tumor Necrosis Factor Alpha, Active Protein
RPU60320-02 100 µg

Dog Tumor Necrosis Factor Alpha, Active Protein

Sign In for Pricing
View Details
Dog Tumor Necrosis Factor Alpha, Active Protein
RPU60320-03 1 mg

Dog Tumor Necrosis Factor Alpha, Active Protein

Sign In for Pricing
View Details
Boc-4-fluoro-D-beta-homophenylalanine
265420-01 250 mg

Boc-4-fluoro-D-beta-homophenylalanine

Sign In for Pricing
View Details