Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHO Monoclonal MMP-9 Antibody (Yeda patent anti-MMP-9) - Humanized, IgG2SA - (Dry Ice)
NBP3-28864-100ug 100 µg

CHO Monoclonal MMP-9 Antibody (Yeda patent anti-MMP-9) - Humanized, IgG2SA - (Dry Ice)

Sign In for Pricing
View Details
Nckap1l Mouse shRNA Plasmid (Locus ID 105855)
TL505734 1 Kit

Nckap1l Mouse shRNA Plasmid (Locus ID 105855)

Sign In for Pricing
View Details
Fgfbp1 (NM_022603) Rat Tagged Lenti ORF Clone
RR212218L3 10 µg

Fgfbp1 (NM_022603) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TMEM179 (NM_207379) Human Tagged ORF Clone
RG217797 10 µg

TMEM179 (NM_207379) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Nup62 shRNA (UAS) - Lentiviral mouseNup62 shRNA (UAS, GFP) (25)
GTR15175508 1 Vial

Lentiviral mouse Nup62 shRNA (UAS) - Lentiviral mouseNup62 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Standard solution fluoride, 100 mg/l F- (bottle 230 ml)
HI7071 1 Each

Standard solution fluoride, 100 mg/l F- (bottle 230 ml)

Sign In for Pricing
View Details