Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ mmu-miR-6994-5p miRNA Agomir/Antagomir
AM4017 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-6994-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Rat Chimerin 2 (CHN2) ELISA Kit
abx506578 96 Tests

Rat Chimerin 2 (CHN2) ELISA Kit

Sign In for Pricing
View Details
DFNA57 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV722710 1.0 µg DNA

DFNA57 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
C15orf32 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0307105 3x 1.0 µg

C15orf32 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Nucleoporin 160kDa (NUP160)
MBS2018675-01 0.01 mg

Recombinant Nucleoporin 160kDa (NUP160)

Sign In for Pricing
View Details
Recombinant Nucleoporin 160kDa (NUP160)
MBS2018675-02 0.05 mg

Recombinant Nucleoporin 160kDa (NUP160)

Sign In for Pricing
View Details