Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STEAP3 (Metalloreductase STEAP3, STEAP Family Member 3, Metalloreductase)
493031 100 µL

STEAP3 (Metalloreductase STEAP3, STEAP Family Member 3, Metalloreductase)

Sign In for Pricing
View Details
Recombinant Chlamydia pneumoniae YwbM Protein
MBS8126058-01 0.25 mg

Recombinant Chlamydia pneumoniae YwbM Protein

Sign In for Pricing
View Details
Recombinant Chlamydia pneumoniae YwbM Protein
MBS8126058-02 5x 0.25 mg

Recombinant Chlamydia pneumoniae YwbM Protein

Sign In for Pricing
View Details
NAT2 (NM_000015) Human Tagged Lenti ORF Clone
RC209360L2 10 µg

NAT2 (NM_000015) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Neurogenin 2 Recombinant Antibody, RBITC Conjugated
bsm-62177R-RBITC 100 µL

Neurogenin 2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
LSG1 sgRNA CRISPR Lentivector set (Human)
K1240601 3x 1.0 µg

LSG1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details