Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700029P11Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3329304 1.0 µg DNA

1700029P11Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Reep3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4656506 1.0 µg DNA

Reep3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human PRADC1 knockout cell line
ABC-KH12064 1 Vial

Human PRADC1 knockout cell line

Sign In for Pricing
View Details
Phospho-AKT1+AKT2+AKT3 (Tyr315+316+312) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-5193R-APC-Cy5.5 100 µL

Phospho-AKT1+AKT2+AKT3 (Tyr315+316+312) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rhox2b (NM_001099316) Mouse Tagged ORF Clone
MG221509 10 µg

Rhox2b (NM_001099316) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human HOXC13 Protein
E30P12289 20 µg

Recombinant Human HOXC13 Protein

Sign In for Pricing
View Details