Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il1f8 3'UTR GFP Stable Cell Line
TU256221 1.0 mL

Il1f8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TMUB1 Protein Vector (Rat) (pPB-C-His)
PV312010 500 ng

TMUB1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PICP (procollagen I C-terminal propeptide) Human ELISA Kit
F8861 96 Tests

PICP (procollagen I C-terminal propeptide) Human ELISA Kit

Sign In for Pricing
View Details
Polyclonal PDGFRB / PDGFR Beta Antibody
APR02743G 0.05mg

Polyclonal PDGFRB / PDGFR Beta Antibody

Sign In for Pricing
View Details
GMP synthetase / GMPS (1-693, His-tag) Human Protein
AR50228PU-N 250 µg

GMP synthetase / GMPS (1-693, His-tag) Human Protein

Sign In for Pricing
View Details
Rabbit Polyclonal PHF2 Antibody [Alexa Fluor 532]
NB300-162AF532 0.1 mL

Rabbit Polyclonal PHF2 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details