Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATP13A2 Antibody [mFluor Violet 500 SE]
NB110-41486MFV500 0.1 mL

Rabbit Polyclonal ATP13A2 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Mouse NOX4 shRNA Plasmid
abx974073-01 150 µg

Mouse NOX4 shRNA Plasmid

Sign In for Pricing
View Details
Mouse NOX4 shRNA Plasmid
abx974073-02 300 µg

Mouse NOX4 shRNA Plasmid

Sign In for Pricing
View Details
MACC1 Human shRNA Lentiviral Particle (Locus ID 346389)
TL307856V 500 µL Each

MACC1 Human shRNA Lentiviral Particle (Locus ID 346389)

Sign In for Pricing
View Details
Prl7a4 Protein Vector (Rat) (pPB-N-His)
PV296219 500 ng

Prl7a4 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Nucleolar GTP-binding protein 1 (GTPBP4) Mouse ELISA Kit
F4866 96 Tests

Nucleolar GTP-binding protein 1 (GTPBP4) Mouse ELISA Kit

Sign In for Pricing
View Details