Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLOD1 (NM_000302) Human Tagged ORF Clone
RC201969 10 µg

PLOD1 (NM_000302) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-EGFR/ERBB1/HER1 Antibody (R2W80)
RHB86921 100 μg

Anti-EGFR/ERBB1/HER1 Antibody (R2W80)

Sign In for Pricing
View Details
RAB9B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38373154 3x 1.0 µg DNA

RAB9B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Olfr576 Protein Vector (Mouse) (pPM-C-HA)
PV210964 500 ng

Olfr576 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
HN1L Human
OM304834-01 5 µg

HN1L Human

Sign In for Pricing
View Details
HN1L Human
OM304834-02 20 µg

HN1L Human

Sign In for Pricing
View Details