Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque METTL7A Protein, His (Fc)-Avi-tagged
METTL7A-2570R 50 µg

Recombinant Rhesus Macaque METTL7A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Hal sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4826003 1.0 µg DNA

Hal sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
pOTB7-GPC1 Plasmid
PVT19059 2 µg

pOTB7-GPC1 Plasmid

Sign In for Pricing
View Details
TAGAP (T-cell Activation Rho GTPase-activating Protein, T-cell Activation GTPase-activating Protein, TAGAP1, FKSG15) (Biotin)
MBS6502043-01 0.1 mL

TAGAP (T-cell Activation Rho GTPase-activating Protein, T-cell Activation GTPase-activating Protein, TAGAP1, FKSG15) (Biotin)

Sign In for Pricing
View Details
TAGAP (T-cell Activation Rho GTPase-activating Protein, T-cell Activation GTPase-activating Protein, TAGAP1, FKSG15) (Biotin)
MBS6502043-02 5x 0.1 mL

TAGAP (T-cell Activation Rho GTPase-activating Protein, T-cell Activation GTPase-activating Protein, TAGAP1, FKSG15) (Biotin)

Sign In for Pricing
View Details
Pid1 Mouse shRNA Plasmid (Locus ID 98496)
TL505556 1 Kit

Pid1 Mouse shRNA Plasmid (Locus ID 98496)

Sign In for Pricing
View Details