Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human OTUD7B, His-tagged
OTUD7B-1481H 25 µg

Recombinant Human OTUD7B, His-tagged

Sign In for Pricing
View Details
ALDH6A1 (NM_005589) Human Untagged Clone
SC116671 10 µg

ALDH6A1 (NM_005589) Human Untagged Clone

Sign In for Pricing
View Details
Rat Placenta Frozen Sections, E12
RF-413-12 10 Slides

Rat Placenta Frozen Sections, E12

Sign In for Pricing
View Details
Rat Monoclonal EGFR Antibody (423103) [DyLight 488]
FAB10951K 0.1 mL

Rat Monoclonal EGFR Antibody (423103) [DyLight 488]

Sign In for Pricing
View Details
Procyanidin B2 3,3-di-O-gallate
M25040-01 1 g

Procyanidin B2 3,3-di-O-gallate

Sign In for Pricing
View Details
Procyanidin B2 3,3-di-O-gallate
M25040-02 100 mg

Procyanidin B2 3,3-di-O-gallate

Sign In for Pricing
View Details