Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

REG3A Recombinant Protein (Rat)
RP224042 100 µg

REG3A Recombinant Protein (Rat)

Sign In for Pricing
View Details
PNKD Recombinant Protein (Mouse)
RP163115 100 µg

PNKD Recombinant Protein (Mouse)

Sign In for Pricing
View Details
BRE Polyclonal Antibody
ABP57067-01 30 µL

BRE Polyclonal Antibody

Sign In for Pricing
View Details
BRE Polyclonal Antibody
ABP57067-02 100 µL

BRE Polyclonal Antibody

Sign In for Pricing
View Details
BRE Polyclonal Antibody
ABP57067-03 200 µL

BRE Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Treponema Pallidum asnA Protein (aa 1-330) (strain SS14)
VAng-Cr1474-50gEcoli 50 µg (E. coli)

Recombinant Treponema Pallidum asnA Protein (aa 1-330) (strain SS14)

Sign In for Pricing
View Details