Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethanolamine-13C2
164059 10 mg

Ethanolamine-13C2

Sign In for Pricing
View Details
Sephs2 (NM_001079889) Rat Tagged ORF Clone
RR209287 10 µg

Sephs2 (NM_001079889) Rat Tagged ORF Clone

Sign In for Pricing
View Details
ELISA kit for Human SA (Sialic Acid)
E-EL-H2024 96 Tests

ELISA kit for Human SA (Sialic Acid)

Sign In for Pricing
View Details
Anti-SIM2 Antibody
A1918-100 100 µL

Anti-SIM2 Antibody

Sign In for Pricing
View Details
Human Proteasome Subunit Beta Type 1 (PSMB1) ELISA Kit
abx382509 96 Tests

Human Proteasome Subunit Beta Type 1 (PSMB1) ELISA Kit

Sign In for Pricing
View Details
AFViolet 450 Anti-Mouse CD4 Antibody
RD30234F-01 25 µg

AFViolet 450 Anti-Mouse CD4 Antibody

Sign In for Pricing
View Details