Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TOP2A Antibody (TOP2A/1362) [Alexa Fluor 700]
NBP2-54545AF700 100 µL

Mouse Monoclonal TOP2A Antibody (TOP2A/1362) [Alexa Fluor 700]

Sign In for Pricing
View Details
Anti-Human LRRC15/LIB Antibody (SAA0773), APC
MBS1584932-01 50 Tests

Anti-Human LRRC15/LIB Antibody (SAA0773), APC

Sign In for Pricing
View Details
Anti-Human LRRC15/LIB Antibody (SAA0773), APC
MBS1584932-02 100 Tests

Anti-Human LRRC15/LIB Antibody (SAA0773), APC

Sign In for Pricing
View Details
Anti-Human LRRC15/LIB Antibody (SAA0773), APC
MBS1584932-03 5x 100 Tests

Anti-Human LRRC15/LIB Antibody (SAA0773), APC

Sign In for Pricing
View Details
NDUFS2 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 2, Mitochondrial, Complex I-49kD, CI-49kD, NADH-ubiquinone Oxidoreductase 49kD Subunit)
130235 50 µg

NDUFS2 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 2, Mitochondrial, Complex I-49kD, CI-49kD, NADH-ubiquinone Oxidoreductase 49kD Subunit)

Sign In for Pricing
View Details
Mouse Monoclonal PEX14 Antibody (1G12)
H00005195-M01 0.1 mg

Mouse Monoclonal PEX14 Antibody (1G12)

Sign In for Pricing
View Details