Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Mouse PKCe (Protein Kinase C Epsilon)
E-EL-M0975 96 Tests

ELISA kit for Mouse PKCe (Protein Kinase C Epsilon)

Sign In for Pricing
View Details
Lentiviral mouse Tspan15 shRNA (UAS) - Lentiviral mouse Tspan15 shRNA (UAS) plasmid
GTR15231175 1 Vial

Lentiviral mouse Tspan15 shRNA (UAS) - Lentiviral mouse Tspan15 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse TMEM261 shRNA Plasmid
abx975865-01 150 µg

Mouse TMEM261 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TMEM261 shRNA Plasmid
abx975865-02 300 µg

Mouse TMEM261 shRNA Plasmid

Sign In for Pricing
View Details
Cyclin B1 (CCNB1) Rabbit Polyclonal Antibody
TA319230 100 µg

Cyclin B1 (CCNB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para
MBS6123292-01 0.1 mL

HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para

Sign In for Pricing
View Details