Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 (NCAM-L1, CAML1, HSAS1, Hyd, L1 Cell Adhesion Molecule, L1-NCAM, MASA, MIC5, NCAM-L1, Nerve-growth factor-inducible large external GlycoProtein, Neural cell Adhesion Molecule L1, NILE, S10, SPG1) (APC)
172042-AF-APC 100 µL

CD171 (NCAM-L1, CAML1, HSAS1, Hyd, L1 Cell Adhesion Molecule, L1-NCAM, MASA, MIC5, NCAM-L1, Nerve-growth factor-inducible large external GlycoProtein, Neural cell Adhesion Molecule L1, NILE, S10, SPG1) (APC)

Sign In for Pricing
View Details
SLC10A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2166508 1.0 µg DNA

SLC10A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Hsa-miR-4755-3p inhibitor
HY-RI01369-01 5 nmol

Hsa-miR-4755-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-4755-3p inhibitor
HY-RI01369-02 20 nmol

Hsa-miR-4755-3p inhibitor

Sign In for Pricing
View Details
Lentiviral mouse Smg8 shRNA (UAS) - Lentiviral mouse Smg8 shRNA (UAS) plasmid
GTR15264607 1 Vial

Lentiviral mouse Smg8 shRNA (UAS) - Lentiviral mouse Smg8 shRNA (UAS) plasmid

Sign In for Pricing
View Details
EIF4EBP2 Protein Vector (Human) (pPB-C-His)
PV013969 500 ng

EIF4EBP2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details