Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-224-3p miRNA Inhibitor
CIR0484-01 10 nmol

Rno-miR-224-3p miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-224-3p miRNA Inhibitor
CIR0484-02 20 nmol

Rno-miR-224-3p miRNA Inhibitor

Sign In for Pricing
View Details
SNORD114-24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44716111 3x 1.0 µg

SNORD114-24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Olr1767 (NM_001000491) Rat Tagged ORF Clone
RR204872 10 µg

Olr1767 (NM_001000491) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal ZBTB7A/Pokemon Antibody [Alexa Fluor 488]
NB100-761AF488 0.1 mL

Rabbit Polyclonal ZBTB7A/Pokemon Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Guanylate cyclase activator 2B (HRP)
318234-01 50 µg

Guanylate cyclase activator 2B (HRP)

Sign In for Pricing
View Details