Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCblR/CD320, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TCblR/CD320 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcblr-cd320-protein-mouse-hek293-his.html

Purity

94.50

Smiles

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Formula

54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

Molecular Weight

Approximately 47.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Uncharacterized protein C1orf100, C1orf100 ELISA KIT
ELI-49327h 96 Tests

Human Uncharacterized protein C1orf100, C1orf100 ELISA KIT

Sign In for Pricing
View Details
16-Epinormacusine B
MF-0040631 5 mg

16-Epinormacusine B

Sign In for Pricing
View Details
COL1A1, CT (COL1A1, Collagen alpha-1 (I) chain, Alpha-1 type I collagen) (FITC)
034087-FITC 200 µL

COL1A1, CT (COL1A1, Collagen alpha-1 (I) chain, Alpha-1 type I collagen) (FITC)

Sign In for Pricing
View Details
Scrn3 (NM_001013162) Rat Tagged ORF Clone
RR200821 10 µg

Scrn3 (NM_001013162) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Minar2 activation kit by CRISPRa
GA213779 1 Kit

Mouse Minar2 activation kit by CRISPRa

Sign In for Pricing
View Details
SJPYT-310
MF-0113796-01 10 mg

SJPYT-310

Sign In for Pricing
View Details