Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (157a.a)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (157a.a), consists of 157 amino acids, produced by E.coli with tag free.

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (157a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-157a-a.html

Purity

98.0

Smiles

GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-4 (G132-S288) (Accession)

Molecular Weight

Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[3]Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11 (1-2) :41-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DPP10 ELISA Kit (Colorimetric)
NBP2-82476 1 Kit

Human DPP10 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Rabbit Polyclonal SIX6 Antibody [Alexa Fluor 350]
NBP2-98116AF350 0.1 mL

Rabbit Polyclonal SIX6 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Nocturnin Polyclonal Antibody Cy5 Conjugated
MBS9460373-01 0.1 mL

Nocturnin Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details
Nocturnin Polyclonal Antibody Cy5 Conjugated
MBS9460373-02 5x 0.1 mL

Nocturnin Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details
ADAM5P sgRNA CRISPR Lentivector (Human) (Target 3)
K0041304 1.0 µg DNA

ADAM5P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
hsa-miR-4677-5p miRNA Antagomir
MBS8317436-01 10 nmol

hsa-miR-4677-5p miRNA Antagomir

Sign In for Pricing
View Details