Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-1, Human (244a.a, HEK293, His, solution)

Kallikrein-1 protein cleaves bonds in kininogen to release Lys-bradykinin. It also cleaves Neisseria meningitidis NHBA in saliva during microbial infection.Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution) is the recombinant human-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-1-protein-human-hek-293-his.html

Purity

98.0

Smiles

PPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS

Molecular Formula

3816 (Gene_ID) AAH05313.1 (P19-S262) (Accession)

Molecular Weight

38-55 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elicitor peptide AtPep1
PE16964-01 1 mg

Elicitor peptide AtPep1

Sign In for Pricing
View Details
Elicitor peptide AtPep1
PE16964-02 10 mg

Elicitor peptide AtPep1

Sign In for Pricing
View Details
Elicitor peptide AtPep1
PE16964-03 100 mg

Elicitor peptide AtPep1

Sign In for Pricing
View Details
Mouse C1qbp/Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit
orb1661375 96 Tests

Mouse C1qbp/Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Chicken CD28 Monoclonal Antibody-[Biotin]
VD7N320 1 Each

Mouse Anti-Chicken CD28 Monoclonal Antibody-[Biotin]

Sign In for Pricing
View Details
FHL1 (Four And A Half LIM Domains Protein 1, FHL-1, Skeletal Muscle LIM-protein 1, SLIM 1, SLIM, SLIM1)
126807 100 µg

FHL1 (Four And A Half LIM Domains Protein 1, FHL-1, Skeletal Muscle LIM-protein 1, SLIM 1, SLIM, SLIM1)

Sign In for Pricing
View Details