Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G7, Mouse (HEK293, His)

The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups. PLA2G7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLA2G7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g7-protein-mouse-440a-a-hek293-his.html

Purity

95.0

Smiles

FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN

Molecular Formula

27226 (Gene_ID) Q60963/NP_038765.2 (F22-N440) (Accession)

Molecular Weight

Approximately 52-65 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Keratin 9 (KRT9) Antibody Pair Kit (with Standard)
MBS2099100-01 5x 96 Tests

Human Keratin 9 (KRT9) Antibody Pair Kit (with Standard)

Ask
View Details
Human Keratin 9 (KRT9) Antibody Pair Kit (with Standard)
MBS2099100-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Keratin 9 (KRT9) Antibody Pair Kit (with Standard)

Ask
View Details
Human Keratin 9 (KRT9) Antibody Pair Kit (with Standard)
MBS2099100-03 10x 96 Tests

Human Keratin 9 (KRT9) Antibody Pair Kit (with Standard)

Ask
View Details
Human Keratin 9 (KRT9) Antibody Pair Kit (with Standard)
MBS2099100-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Keratin 9 (KRT9) Antibody Pair Kit (with Standard)

Ask
View Details
Integrin beta1 (Phospho-Thr789) Antibody
MBS9508612-01 0.05 mL

Integrin beta1 (Phospho-Thr789) Antibody

Ask
View Details
Integrin beta1 (Phospho-Thr789) Antibody
MBS9508612-02 0.1 mL

Integrin beta1 (Phospho-Thr789) Antibody

Ask
View Details