Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G7, Mouse (HEK293, His)

The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups. PLA2G7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLA2G7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g7-protein-mouse-440a-a-hek293-his.html

Purity

95.0

Smiles

FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN

Molecular Formula

27226 (Gene_ID) Q60963/NP_038765.2 (F22-N440) (Accession)

Molecular Weight

Approximately 52-65 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF384, CT (ZNF384, CAGH1, CIZ, NMP4, TNRC1, Zinc finger protein 384, CAG repeat protein 1, CAS-interacting zinc finger protein, Nuclear matrix transcription factor 4, Trinucleotide repeat-containing gene 1 protein) (Biotin) discontinued
044213-Biotin 200 µL

ZNF384, CT (ZNF384, CAGH1, CIZ, NMP4, TNRC1, Zinc finger protein 384, CAG repeat protein 1, CAS-interacting zinc finger protein, Nuclear matrix transcription factor 4, Trinucleotide repeat-containing gene 1 protein) (Biotin) discontinued

Ask
View Details
SDCCAG8 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-7011R-BF350 100 µL

SDCCAG8 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Ask
View Details
Mouse B3gnt5 activation kit by CRISPRa
GA212091 1 Kit

Mouse B3gnt5 activation kit by CRISPRa

Ask
View Details
Na+/K+-ATPase alpha1 (Phospho-Tyr260) Antibody
MBS9525941-01 0.05 mL

Na+/K+-ATPase alpha1 (Phospho-Tyr260) Antibody

Ask
View Details
Na+/K+-ATPase alpha1 (Phospho-Tyr260) Antibody
MBS9525941-02 0.1 mL

Na+/K+-ATPase alpha1 (Phospho-Tyr260) Antibody

Ask
View Details
Na+/K+-ATPase alpha1 (Phospho-Tyr260) Antibody
MBS9525941-03 5x 0.1 mL

Na+/K+-ATPase alpha1 (Phospho-Tyr260) Antibody

Ask
View Details