Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G7, Mouse (HEK293, His)

The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups. PLA2G7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLA2G7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g7-protein-mouse-440a-a-hek293-his.html

Purity

95.0

Smiles

FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN

Molecular Formula

27226 (Gene_ID) Q60963/NP_038765.2 (F22-N440) (Accession)

Molecular Weight

Approximately 52-65 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SPIN4 cDNA Clone
MBS1271226-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

SPIN4 cDNA Clone

Ask
View Details
SPIN4 cDNA Clone
MBS1271226-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

SPIN4 cDNA Clone

Ask
View Details
Human Suppressors of cytokine signaling 3 (SOCS-3) ELISA Kit
AE57645HU-01 48 Tests

Human Suppressors of cytokine signaling 3 (SOCS-3) ELISA Kit

Ask
View Details
Human Suppressors of cytokine signaling 3 (SOCS-3) ELISA Kit
AE57645HU-02 96 Tests

Human Suppressors of cytokine signaling 3 (SOCS-3) ELISA Kit

Ask
View Details
VKORC1, NT (VKOR, MST134, MST576, VKCFD2, EDTP308, VKOR, MSTP134, MSTP576, UNQ308/PRO351, Vitamin K Epoxide Reductase Complex Subunit 1, Vitamin K1 2, 3-Epoxide Reductase Subunit 1)
352641 100 µg

VKORC1, NT (VKOR, MST134, MST576, VKCFD2, EDTP308, VKOR, MSTP134, MSTP576, UNQ308/PRO351, Vitamin K Epoxide Reductase Complex Subunit 1, Vitamin K1 2, 3-Epoxide Reductase Subunit 1)

Ask
View Details
Wilm's Tumor Protein (Wt1)
MBS603217-01 0.2 mg

Wilm's Tumor Protein (Wt1)

Ask
View Details